Lineage for d1uwra_ (1uwr A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins)
  6. Protein beta-Glycosidase [51531] (2 species)
  7. Species Sulfolobus solfataricus [TaxId:2287] [51532] (9 PDB entries)
    Uniprot P22498
  8. Domain d1uwra_: 1uwr A: [108071]
    complexed with act, gaf

Details for d1uwra_

PDB Entry: 1uwr (more details), 2.14 Å

PDB Description: structure of beta-glycosidase from sulfolobus solfataricus in complex with 2-deoxy-2-fluoro-galactose
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1uwra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwra_ c.1.8.4 (A:) beta-Glycosidase {Sulfolobus solfataricus [TaxId: 2287]}
mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
vppvkplrh

SCOPe Domain Coordinates for d1uwra_ are not available.

Timeline for d1uwra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uwrb_