Lineage for d1uw0a_ (1uw0 A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624310Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 624311Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (14 families) (S)
  5. 624544Family g.39.1.12: PARP-type zinc finger [111445] (1 protein)
    Pfam 00645
  6. 624545Protein DNA ligase III [111446] (1 species)
  7. 624546Species Human (Homo sapiens) [TaxId:9606] [111447] (1 PDB entry)
  8. 624547Domain d1uw0a_: 1uw0 A: [108063]
    complexed with zn

Details for d1uw0a_

PDB Entry: 1uw0 (more details)

PDB Description: solution structure of the zinc-finger domain from dna ligase iiia

SCOP Domain Sequences for d1uw0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw0a_ g.39.1.12 (A:) DNA ligase III {Human (Homo sapiens)}
maeqrfcvdyakrgtagckkckekivkgvcrigkvvpnpfsesggdmkewyhikcmfekl
erarattkkiedltelegweelednekeqitqhiadlsskaagtpkkkavvqakltt

SCOP Domain Coordinates for d1uw0a_:

Click to download the PDB-style file with coordinates for d1uw0a_.
(The format of our PDB-style files is described here.)

Timeline for d1uw0a_: