SCOPe 2.05: Domain d1uuya_: 1uuy A:

Lineage for d1uuya_ (1uuy A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.1: MogA-like [53219] (6 proteins)

6. Protein Plant CNX1 G domain [69537] (1 species)
   gephyrin homologue

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [69538] (6 PDB entries)
   Uniprot Q39054 464-623

8. Domain d1uuya_: 1uuy A: [108059]
   complexed with amp, cu1, fmt, imd, mte, ppi

Details for d1uuya_

PDB Entry: 1uuy, 1.45 Å

PDB Description: structure of a molybdopterin-bound cnx1g domain links molybdenum and copper metabolism

PDB Compounds: (A:) molybdopterin biosynthesis cnx1

SCOPe Domain Sequences for d1uuya_:

Sequence; same for both SEQRES and ATOM records:

>d1uuya_ c.57.1.1 (A:) Plant CNX1 G domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverikdi
lqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfamla
rsaagirgstliinmpgnpnavaecmeallpalkhalkqik

Timeline for d1uuya_:

• d1uuya_ first appeared in SCOP 1.69
  
• d1uuya_ appears in SCOPe 2.04
  
• d1uuya_ appears in SCOPe 2.06
  
• d1uuya_ appears in the current release, SCOPe 2.08