![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
![]() | Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) ![]() |
![]() | Family c.57.1.1: MogA-like [53219] (6 proteins) |
![]() | Protein Plant CNX1 G domain [69537] (1 species) gephyrin homologue |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [69538] (6 PDB entries) Uniprot Q39054 464-623 |
![]() | Domain d1uuya_: 1uuy A: [108059] complexed with amp, cu1, fmt, imd, mte, ppi |
PDB Entry: 1uuy (more details), 1.45 Å
SCOPe Domain Sequences for d1uuya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uuya_ c.57.1.1 (A:) Plant CNX1 G domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverikdi lqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfamla rsaagirgstliinmpgnpnavaecmeallpalkhalkqik
Timeline for d1uuya_: