Lineage for d1uuxa_ (1uux A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890089Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2890090Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2890091Family c.57.1.1: MogA-like [53219] (6 proteins)
  6. 2890134Protein Plant CNX1 G domain [69537] (1 species)
    gephyrin homologue
  7. 2890135Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [69538] (6 PDB entries)
    Uniprot Q39054 464-623
  8. 2890137Domain d1uuxa_: 1uux A: [108058]
    complexed with cu1, fmt, imd, mte, ppi

Details for d1uuxa_

PDB Entry: 1uux (more details), 1.6 Å

PDB Description: structure of a molybdopterin-bound cnx1g domain links molybdenum and copper metabolism
PDB Compounds: (A:) molybdopterin biosynthesis cnx1

SCOPe Domain Sequences for d1uuxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uuxa_ c.57.1.1 (A:) Plant CNX1 G domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverikdi
lqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfamls
rsaagirgstliinmpgnpnavaecmeallpalkhalkqia

SCOPe Domain Coordinates for d1uuxa_:

Click to download the PDB-style file with coordinates for d1uuxa_.
(The format of our PDB-style files is described here.)

Timeline for d1uuxa_: