SCOPe 2.08: Domain d1uupc1: 1uup C:3001-3107

Lineage for d1uupc1 (1uup C:3001-3107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
   Uniprot P08095

8. Domain d1uupc1: 1uup C:3001-3107 [108054]
   Other proteins in same PDB: d1uupa2, d1uupb2, d1uupc2, d1uupd2
   complexed with zn

Details for d1uupc1

PDB Entry: 1uup, 2.6 Å

PDB Description: crystal structure of a dimeric form of streptococcal pyrogenic exotoxin a (spea1).

PDB Compounds: (C:) exotoxin type a

SCOPe Domain Sequences for d1uupc1:

Sequence; same for both SEQRES and ATOM records:

>d1uupc1 b.40.2.2 (C:3001-3107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

Timeline for d1uupc1:

• d1uupc1 first appeared in SCOP 1.69
  
• d1uupc1 appears in SCOPe 2.07