Lineage for d1uupb2 (1uup B:2108-2221)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541472Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2541473Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2541578Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 2541579Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)
    Uniprot P08095
  8. 2541587Domain d1uupb2: 1uup B:2108-2221 [108053]
    Other proteins in same PDB: d1uupa1, d1uupb1, d1uupc1, d1uupd1
    complexed with zn

Details for d1uupb2

PDB Entry: 1uup (more details), 2.6 Å

PDB Description: crystal structure of a dimeric form of streptococcal pyrogenic exotoxin a (spea1).
PDB Compounds: (B:) exotoxin type a

SCOPe Domain Sequences for d1uupb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uupb2 d.15.6.1 (B:2108-2221) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievylttk

SCOPe Domain Coordinates for d1uupb2:

Click to download the PDB-style file with coordinates for d1uupb2.
(The format of our PDB-style files is described here.)

Timeline for d1uupb2: