SCOP 1.73: Domain d1uupa1: 1uup A:1001-1107

Lineage for d1uupa1 (1uup A:1001-1107)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.40: OB-fold [50198] (12 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
Domain d1uupa1: 1uup A:1001-1107 [108050]
Other proteins in same PDB: d1uupa2, d1uupb2, d1uupc2, d1uupd2

Details for d1uupa1

PDB Entry: 1uup (more details), 2.6 Å

PDB Description: crystal structure of a dimeric form of streptococcal pyrogenic exotoxin a (spea1).

PDB Compounds: (A:) exotoxin type a

SCOP Domain Sequences for d1uupa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uupa1 b.40.2.2 (A:1001-1107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOP Domain Coordinates for d1uupa1:

Click to download the PDB-style file with coordinates for d1uupa1.
(The format of our PDB-style files is described here.)

Timeline for d1uupa1: