Lineage for d1uupa1 (1uup A:1001-1107)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
    Uniprot P08095
  8. Domain d1uupa1: 1uup A:1001-1107 [108050]
    Other proteins in same PDB: d1uupa2, d1uupb2, d1uupc2, d1uupd2
    complexed with zn

Details for d1uupa1

PDB Entry: 1uup (more details), 2.6 Å

PDB Description: crystal structure of a dimeric form of streptococcal pyrogenic exotoxin a (spea1).
PDB Compounds: (A:) exotoxin type a

SCOPe Domain Sequences for d1uupa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uupa1 b.40.2.2 (A:1001-1107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOPe Domain Coordinates for d1uupa1 are not available.

Timeline for d1uupa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uupa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1uupb1, d1uupb2, d1uupc1, d1uupc2, d1uupd1, d1uupd2