| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.221: Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain [109924] (1 superfamily) dimer of 3-helical segments; consists of two subdomains: 4-helical bundle and coiled coil |
Superfamily a.221.1: Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain [109925] (1 family) ![]() |
| Family a.221.1.1: Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain [109926] (1 protein) |
| Protein Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain [109927] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [109928] (1 PDB entry) Uniprot P43035 1-85 |
| Domain d1uujd_: 1uuj D: [108049] complexed with act, bez, so4 |
PDB Entry: 1uuj (more details), 1.75 Å
SCOPe Domain Sequences for d1uujd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uujd_ a.221.1.1 (D:) Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
mvlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsvir
lqkkvmelesklneakeef
Timeline for d1uujd_: