Lineage for d1uujb_ (1uuj B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737761Fold a.221: Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain [109924] (1 superfamily)
    dimer of 3-helical segments; consists of two subdomains: 4-helical bundle and coiled coil
  4. 2737762Superfamily a.221.1: Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain [109925] (1 family) (S)
  5. 2737763Family a.221.1.1: Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain [109926] (1 protein)
  6. 2737764Protein Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain [109927] (1 species)
  7. 2737765Species Mouse (Mus musculus) [TaxId:10090] [109928] (1 PDB entry)
    Uniprot P43035 1-85
  8. 2737767Domain d1uujb_: 1uuj B: [108047]
    complexed with act, bez, so4

Details for d1uujb_

PDB Entry: 1uuj (more details), 1.75 Å

PDB Description: n-terminal domain of lissencephaly-1 protein (lis-1)
PDB Compounds: (B:) platelet-activating factor acetylhydrolase ib alpha subunit

SCOPe Domain Sequences for d1uujb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uujb_ a.221.1.1 (B:) Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
vlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsvirl
qkkvmelesklnea

SCOPe Domain Coordinates for d1uujb_:

Click to download the PDB-style file with coordinates for d1uujb_.
(The format of our PDB-style files is described here.)

Timeline for d1uujb_: