Lineage for d1uu5a_ (1uu5 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780056Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)
  7. 2780060Species Humicola grisea [TaxId:5527] [101655] (5 PDB entries)
    Uniprot Q8NJY3 31-254
  8. 2780065Domain d1uu5a_: 1uu5 A: [108043]
    complexed with act

Details for d1uu5a_

PDB Entry: 1uu5 (more details), 1.67 Å

PDB Description: x-ray crystal structure of the catalytic domain of humicola grisea cel12a soaked with cellotetraose
PDB Compounds: (A:) endo-beta-1,4-glucanase

SCOPe Domain Sequences for d1uu5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uu5a_ b.29.1.11 (A:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Humicola grisea [TaxId: 5527]}
eirslcelygywsgngyellnnlwgkdtatsgwqctyldgtnnggiqwstawewqgapdn
vksypyvgkqiqrgrkisdinsmrtsvswtydrtdiranvaydvftardpdhpnwggdye
lmiwlaryggiypigtfhsqvnlagrtwdlwtgyngnmrvysflppsgdirdfscdikdf
fnylernhgypareqnlivyqvgtecftggparftcrdfradlw

SCOPe Domain Coordinates for d1uu5a_:

Click to download the PDB-style file with coordinates for d1uu5a_.
(The format of our PDB-style files is described here.)

Timeline for d1uu5a_: