Lineage for d1uu4a_ (1uu4 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 460534Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 460535Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)
  7. 460539Species Humicola grisea [TaxId:5527] [101655] (5 PDB entries)
  8. 460542Domain d1uu4a_: 1uu4 A: [108042]

Details for d1uu4a_

PDB Entry: 1uu4 (more details), 1.49 Å

PDB Description: x-ray crystal structure of the catalytic domain of humicola grisea cel12a in complex with cellobiose

SCOP Domain Sequences for d1uu4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uu4a_ b.29.1.11 (A:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Humicola grisea}
eirslcelygywsgngyellnnlwgkdtatsgwqctyldgtnnggiqwstawewqgapdn
vksypyvgkqiqrgrkisdinsmrtsvswtydrtdiranvaydvftardpdhpnwggdye
lmiwlaryggiypigtfhsqvnlagrtwdlwtgyngnmrvysflppsgdirdfscdikdf
fnylernhgypareqnlivyqvgtecftggparftcrdfradlw

SCOP Domain Coordinates for d1uu4a_:

Click to download the PDB-style file with coordinates for d1uu4a_.
(The format of our PDB-style files is described here.)

Timeline for d1uu4a_: