Lineage for d1utyb_ (1uty B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 473219Fold b.147: BTV NS2-like ssRNA-binding domain (N-terminal half of Pfam 04514) [110131] (1 superfamily)
    sandwich; 9 strands in 2 sheets; unusual topology with 2 crossover loops
  4. 473220Superfamily b.147.1: BTV NS2-like ssRNA-binding domain (N-terminal half of Pfam 04514) [110132] (1 family) (S)
  5. 473221Family b.147.1.1: BTV NS2-like ssRNA-binding domain (N-terminal half of Pfam 04514) [110133] (1 protein)
  6. 473222Protein Nonstructural protein NS2 [110134] (1 species)
  7. 473223Species Bluetongue virus [TaxId:40051] [110135] (1 PDB entry)
  8. 473225Domain d1utyb_: 1uty B: [108037]

Details for d1utyb_

PDB Entry: 1uty (more details), 2.4 Å

PDB Description: Crystal structure of an RNA binding domain of Bluetongue virus non-structural protein 2(NS2)

SCOP Domain Sequences for d1utyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utyb_ b.147.1.1 (B:) Nonstructural protein NS2 {Bluetongue virus}
ftknifvldvtaktlcgaiaklssqpycqikigrvvafkpvknpepkgyvlnvpgpgayr
iqdgqdiislmltphgveatterweewkfegvsvtpmatrvqyngvmvdaeikyckgmgi
vqpymrndfdrnempdlpgvmrsnydirelrqk

SCOP Domain Coordinates for d1utyb_:

Click to download the PDB-style file with coordinates for d1utyb_.
(The format of our PDB-style files is described here.)

Timeline for d1utyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1utya_