SCOPe 2.08: Domain d1utxb_: 1utx B:

Lineage for d1utxb_ (1utx B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)

6. Protein Putative transcription regulator CylR2 [109811] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [109812] (10 PDB entries)
   Uniprot Q8VL32

8. Domain d1utxb_: 1utx B: [108035]
   complexed with iod, na

Details for d1utxb_

PDB Entry: 1utx, 1.9 Å

PDB Description: regulation of cytolysin expression by enterococcus faecalis: role of cylr2

PDB Compounds: (B:) cylr2

SCOPe Domain Sequences for d1utxb_:

Sequence; same for both SEQRES and ATOM records:

>d1utxb_ a.35.1.3 (B:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]}
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
fqwqpe

Timeline for d1utxb_:

• d1utxb_ first appeared in SCOP 1.69
  
• d1utxb_ appears in SCOPe 2.07