Lineage for d1utxb_ (1utx B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709414Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 2709463Protein Putative transcription regulator CylR2 [109811] (1 species)
  7. 2709464Species Enterococcus faecalis [TaxId:1351] [109812] (10 PDB entries)
    Uniprot Q8VL32
  8. 2709468Domain d1utxb_: 1utx B: [108035]
    complexed with iod, na

Details for d1utxb_

PDB Entry: 1utx (more details), 1.9 Å

PDB Description: regulation of cytolysin expression by enterococcus faecalis: role of cylr2
PDB Compounds: (B:) cylr2

SCOPe Domain Sequences for d1utxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utxb_ a.35.1.3 (B:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]}
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
fqwqpe

SCOPe Domain Coordinates for d1utxb_:

Click to download the PDB-style file with coordinates for d1utxb_.
(The format of our PDB-style files is described here.)

Timeline for d1utxb_: