SCOP 1.69: Domain d1uthb_: 1uth B:

Lineage for d1uthb_ (1uth B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (28 proteins)

6. Protein LysR-type regulatory protein DntR [110748] (1 species)

7. Species Burkholderia sp. [110749] (2 PDB entries)

8. Domain d1uthb_: 1uth B: [108033]

Details for d1uthb_

PDB Entry: 1uth, 2.2 Å

PDB Description: dntr from burkholderia sp. strain dnt in complex with thiocyanate

SCOP Domain Sequences for d1uthb_:

Sequence; same for both SEQRES and ATOM records:

>d1uthb_ c.94.1.1 (B:) LysR-type regulatory protein DntR {Burkholderia sp.}
alntletalttrdsfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpga
gnlkedmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqfsele
hvgvvalntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcev
pfglttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfsea

Timeline for d1uthb_:

• d1uthb_ is new in SCOP 1.69
  
• d1uthb_ appears in SCOP 1.71
  
• d1uthb_ appears in the current release, SCOPe 2.08