Lineage for d1utaa_ (1uta A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 605230Superfamily d.58.52: Sporulation related repeat [110997] (1 family) (S)
    duplication: one domain contains two repeats of similar sequence and structure
  5. 605231Family d.58.52.1: Sporulation related repeat [110998] (1 protein)
    Pfam 05036; SPOR
  6. 605232Protein Cell division protein FtsN [110999] (1 species)
  7. 605233Species Escherichia coli [TaxId:562] [111000] (1 PDB entry)
  8. 605234Domain d1utaa_: 1uta A: [108029]

Details for d1utaa_

PDB Entry: 1uta (more details)

PDB Description: solution structure of the c-terminal rnp domain from the divisome protein ftsn

SCOP Domain Sequences for d1utaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utaa_ d.58.52.1 (A:) Cell division protein FtsN {Escherichia coli}
kderrwmvqcgsfrgaeqaetvraqlafegfdskittnngwnrvvigpvkgkenadstln
rlkmaghtncirlaagg

SCOP Domain Coordinates for d1utaa_:

Click to download the PDB-style file with coordinates for d1utaa_.
(The format of our PDB-style files is described here.)

Timeline for d1utaa_: