Lineage for d1utaa_ (1uta A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 505721Superfamily d.58.52: Sporulation related repeat (SPOR, Pfam 05036) [110997] (1 family) (S)
    duplication: one domain contains two repeats of similar sequence and structure
  5. 505722Family d.58.52.1: Sporulation related repeat (SPOR, Pfam 05036) [110998] (1 protein)
  6. 505723Protein Cell division protein FtsN [110999] (1 species)
  7. 505724Species Escherichia coli [TaxId:562] [111000] (1 PDB entry)
  8. 505725Domain d1utaa_: 1uta A: [108029]

Details for d1utaa_

PDB Entry: 1uta (more details)

PDB Description: solution structure of the c-terminal rnp domain from the divisome protein ftsn

SCOP Domain Sequences for d1utaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utaa_ d.58.52.1 (A:) Cell division protein FtsN {Escherichia coli}
kderrwmvqcgsfrgaeqaetvraqlafegfdskittnngwnrvvigpvkgkenadstln
rlkmaghtncirlaagg

SCOP Domain Coordinates for d1utaa_:

Click to download the PDB-style file with coordinates for d1utaa_.
(The format of our PDB-style files is described here.)

Timeline for d1utaa_: