Lineage for d1utaa_ (1uta A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955791Superfamily d.58.52: Sporulation related repeat [110997] (2 families) (S)
    duplication: one domain contains two repeats of similar sequence and structure
    automatically mapped to Pfam PF05036
  5. 2955792Family d.58.52.1: Sporulation related repeat [110998] (1 protein)
    Pfam PF05036; SPOR
  6. 2955793Protein Cell division protein FtsN [110999] (1 species)
  7. 2955794Species Escherichia coli [TaxId:562] [111000] (1 PDB entry)
    Uniprot P29131 243-319
  8. 2955795Domain d1utaa_: 1uta A: [108029]

Details for d1utaa_

PDB Entry: 1uta (more details)

PDB Description: solution structure of the c-terminal rnp domain from the divisome protein ftsn
PDB Compounds: (A:) cell division protein ftsn

SCOPe Domain Sequences for d1utaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utaa_ d.58.52.1 (A:) Cell division protein FtsN {Escherichia coli [TaxId: 562]}
kderrwmvqcgsfrgaeqaetvraqlafegfdskittnngwnrvvigpvkgkenadstln
rlkmaghtncirlaagg

SCOPe Domain Coordinates for d1utaa_:

Click to download the PDB-style file with coordinates for d1utaa_.
(The format of our PDB-style files is described here.)

Timeline for d1utaa_: