![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.52: Sporulation related repeat [110997] (2 families) ![]() duplication: one domain contains two repeats of similar sequence and structure automatically mapped to Pfam PF05036 |
![]() | Family d.58.52.1: Sporulation related repeat [110998] (1 protein) Pfam PF05036; SPOR |
![]() | Protein Cell division protein FtsN [110999] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [111000] (1 PDB entry) Uniprot P29131 243-319 |
![]() | Domain d1utaa_: 1uta A: [108029] |
PDB Entry: 1uta (more details)
SCOPe Domain Sequences for d1utaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1utaa_ d.58.52.1 (A:) Cell division protein FtsN {Escherichia coli [TaxId: 562]} kderrwmvqcgsfrgaeqaetvraqlafegfdskittnngwnrvvigpvkgkenadstln rlkmaghtncirlaagg
Timeline for d1utaa_: