Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.6: Dr-family adhesin [110075] (1 protein) Pfam PF04619 |
Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species) |
Species Escherichia coli [TaxId:562] [110077] (11 PDB entries) Uniprot Q57254 P24093 23-159 |
Domain d1ut2e_: 1ut2 E: [108024] complexed with so4 |
PDB Entry: 1ut2 (more details), 3.3 Å
SCOPe Domain Sequences for d1ut2e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ut2e_ b.2.3.6 (E:) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]} gsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalk adtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgq qtntppgnytltltggywa
Timeline for d1ut2e_: