Lineage for d1ut2b_ (1ut2 B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 456653Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 456725Superfamily b.2.3: Bacterial adhesins [49401] (6 families) (S)
  5. 456829Family b.2.3.6: Dr-family adhesin (Pfam 04619) [110075] (1 protein)
  6. 456830Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)
  7. 456831Species Escherichia coli [TaxId:562] [110077] (4 PDB entries)
  8. 456846Domain d1ut2b_: 1ut2 B: [108021]

Details for d1ut2b_

PDB Entry: 1ut2 (more details), 3.3 Å

PDB Description: afae-3 adhesin from escherichia coli

SCOP Domain Sequences for d1ut2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ut2b_ b.2.3.6 (B:) DraA/Afimbrial adhesin Afa-III {Escherichia coli}
gsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalk
adtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgq
qtntppgnytltltggywa

SCOP Domain Coordinates for d1ut2b_:

Click to download the PDB-style file with coordinates for d1ut2b_.
(The format of our PDB-style files is described here.)

Timeline for d1ut2b_: