Lineage for d1ut2b_ (1ut2 B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
    Pfam PF04619
  6. Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)
  7. Species Escherichia coli [TaxId:562] [110077] (11 PDB entries)
    Uniprot Q57254 P24093 23-159
  8. Domain d1ut2b_: 1ut2 B: [108021]
    complexed with so4

Details for d1ut2b_

PDB Entry: 1ut2 (more details), 3.3 Å

PDB Description: afae-3 adhesin from escherichia coli
PDB Compounds: (B:) afimbrial adhesin afa-III

SCOPe Domain Sequences for d1ut2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ut2b_ b.2.3.6 (B:) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
gsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalk
adtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgq
qtntppgnytltltggywa

SCOPe Domain Coordinates for d1ut2b_ are not available.

Timeline for d1ut2b_:

Domains from other chains:
(mouse over for more information)
d1ut2a_, d1ut2c_, d1ut2d_, d1ut2e_, d1ut2f_, d1ut2g_, d1ut2h_, d1ut2i_