SCOP 1.75: Domain d1ut1f_: 1ut1 F:

Lineage for d1ut1f_ (1ut1 F:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (6 families)

5. Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
   Pfam PF04619

6. Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)

7. Species Escherichia coli [TaxId:562] [110077] (7 PDB entries)
   Uniprot Q57254 P24093 23-159

8. Domain d1ut1f_: 1ut1 F: [108019]
   complexed with egl, so4; mutant

Details for d1ut1f_

PDB Entry: 1ut1, 1.7 Å

PDB Description: DraE adhesin from Escherichia Coli

PDB Compounds: (F:) dr hemagglutinin structural subunit

SCOP Domain Sequences for d1ut1f_:

Sequence; same for both SEQRES and ATOM records:

>d1ut1f_ b.2.3.6 (F:) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
qtntppgnytltltggywa

Timeline for d1ut1f_:

• d1ut1f_ first appeared in SCOP 1.69
  
• d1ut1f_ appears in SCOP 1.73
  
• d1ut1f_ appears in SCOPe 2.01
  
• d1ut1f_ appears in the current release, SCOPe 2.08