SCOP 1.69: Domain d1ut1e_: 1ut1 E:

Lineage for d1ut1e_ (1ut1 E:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (6 families)

5. Family b.2.3.6: Dr-family adhesin (Pfam 04619) [110075] (1 protein)

6. Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)

7. Species Escherichia coli [TaxId:562] [110077] (4 PDB entries)

8. Domain d1ut1e_: 1ut1 E: [108018]

Details for d1ut1e_

PDB Entry: 1ut1, 1.7 Å

PDB Description: DraE adhesin from Escherichia Coli

SCOP Domain Sequences for d1ut1e_:

Sequence; same for both SEQRES and ATOM records:

>d1ut1e_ b.2.3.6 (E:) DraA/Afimbrial adhesin Afa-III {Escherichia coli}
gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
qtntppgnytltltggywak

Timeline for d1ut1e_:

• d1ut1e_ is new in SCOP 1.69
  
• d1ut1e_ appears in SCOP 1.71
  
• d1ut1e_ appears in the current release, SCOPe 2.08