Lineage for d1ut1c_ (1ut1 C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 938438Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 938566Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 938742Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
    Pfam PF04619
  6. 938743Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)
  7. 938744Species Escherichia coli [TaxId:562] [110077] (7 PDB entries)
    Uniprot Q57254 P24093 23-159
  8. 938747Domain d1ut1c_: 1ut1 C: [108016]
    complexed with edo, so4

Details for d1ut1c_

PDB Entry: 1ut1 (more details), 1.7 Å

PDB Description: DraE adhesin from Escherichia Coli
PDB Compounds: (C:) dr hemagglutinin structural subunit

SCOPe Domain Sequences for d1ut1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ut1c_ b.2.3.6 (C:) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
qtntppgnytltltggywa

SCOPe Domain Coordinates for d1ut1c_:

Click to download the PDB-style file with coordinates for d1ut1c_.
(The format of our PDB-style files is described here.)

Timeline for d1ut1c_: