SCOP 1.71: Domain d1ut1c_: 1ut1 C:

Lineage for d1ut1c_ (1ut1 C:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (6 families)

5. Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
   Pfam 04619

6. Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)

7. Species Escherichia coli [TaxId:562] [110077] (5 PDB entries)

8. Domain d1ut1c_: 1ut1 C: [108016]

Details for d1ut1c_

PDB Entry: 1ut1, 1.7 Å

PDB Description: DraE adhesin from Escherichia Coli

SCOP Domain Sequences for d1ut1c_:

Sequence; same for both SEQRES and ATOM records:

>d1ut1c_ b.2.3.6 (C:) DraA/Afimbrial adhesin Afa-III {Escherichia coli}
gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
qtntppgnytltltggywa

Timeline for d1ut1c_:

• d1ut1c_ first appeared in SCOP 1.69
  
• d1ut1c_ appears in SCOP 1.73
  
• d1ut1c_ appears in the current release, SCOPe 2.08