SCOP 1.71: Domain d1ut0b_: 1ut0 B:

Lineage for d1ut0b_ (1ut0 B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Cytoglobin [109626] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109627] (6 PDB entries)

8. Domain d1ut0b_: 1ut0 B: [108013]
   complexed with fc6, hem; mutant

Details for d1ut0b_

PDB Entry: 1ut0, 2.1 Å

PDB Description: crystal structure of cytoglobin: the fourth globin type discovered in man displays heme hexa-coordination

SCOP Domain Sequences for d1ut0b_:

Sequence; same for both SEQRES and ATOM records:

>d1ut0b_ a.1.1.2 (B:) Cytoglobin {Human (Homo sapiens)}
elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
efasdfppetqrawaklrgliyshvtaaykevgw

Timeline for d1ut0b_:

• d1ut0b_ first appeared in SCOP 1.69
  
• d1ut0b_ appears in SCOP 1.73
  
• d1ut0b_ appears in the current release, SCOPe 2.08