Lineage for d1usqf_ (1usq F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767793Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
    Pfam PF04619
  6. 2767794Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)
  7. 2767795Species Escherichia coli [TaxId:562] [110077] (11 PDB entries)
    Uniprot Q57254 P24093 23-159
  8. 2767813Domain d1usqf_: 1usq F: [108010]
    complexed with clm, edo, so4

Details for d1usqf_

PDB Entry: 1usq (more details), 1.9 Å

PDB Description: complex of e. coli drae adhesin with chloramphenicol
PDB Compounds: (F:) dr hemagglutinin structural subunit

SCOPe Domain Sequences for d1usqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usqf_ b.2.3.6 (F:) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
qtntppgnytltltggywak

SCOPe Domain Coordinates for d1usqf_:

Click to download the PDB-style file with coordinates for d1usqf_.
(The format of our PDB-style files is described here.)

Timeline for d1usqf_: