SCOP 1.71: Domain d1usqc_: 1usq C:

Lineage for d1usqc_ (1usq C:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (6 families)

5. Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
   Pfam 04619

6. Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)

7. Species Escherichia coli [TaxId:562] [110077] (5 PDB entries)

8. Domain d1usqc_: 1usq C: [108007]

Details for d1usqc_

PDB Entry: 1usq, 1.9 Å

PDB Description: complex of e. coli drae adhesin with chloramphenicol

SCOP Domain Sequences for d1usqc_:

Sequence; same for both SEQRES and ATOM records:

>d1usqc_ b.2.3.6 (C:) DraA/Afimbrial adhesin Afa-III {Escherichia coli}
gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
qtntppgnytltltggywa

Timeline for d1usqc_:

• d1usqc_ first appeared in SCOP 1.69
  
• d1usqc_ appears in SCOP 1.73
  
• d1usqc_ appears in the current release, SCOPe 2.08