SCOPe 2.01: Domain d1usbb1: 1usb B:81-219

Lineage for d1usbb1 (1usb B:81-219)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (19 PDB entries)
   Uniprot P08263

8. Domain d1usbb1: 1usb B:81-219 [108003]
   Other proteins in same PDB: d1usba2, d1usbb2
   complexed with cl, gsh, k

Details for d1usbb1

PDB Entry: 1usb, 2.07 Å

PDB Description: rational design of a novel enzyme - efficient thioester hydrolysis enabled by the incorporation of a single his residue into human glutathione transferase a1-1

PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d1usbb1:

Sequence; same for both SEQRES and ATOM records:

>d1usbb1 a.45.1.1 (B:81-219) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleehrki

Timeline for d1usbb1:

• d1usbb1 first appeared in SCOP 1.69
  
• d1usbb1 appears in SCOP 1.75
  
• d1usbb1 appears in SCOPe 2.02
  
• d1usbb1 appears in the current release, SCOPe 2.08