![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (15 families) ![]() |
![]() | Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins) |
![]() | Protein Class alpha GST [81360] (8 species) |
![]() | Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (15 PDB entries) |
![]() | Domain d1usba2: 1usb A:2-80 [108002] Other proteins in same PDB: d1usba1, d1usbb1 |
PDB Entry: 1usb (more details), 2.07 Å
SCOP Domain Sequences for d1usba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1usba2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1)} aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid gmklvqtrailnyiaskyn
Timeline for d1usba2: