Lineage for d1us6b_ (1us6 B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 437311Fold a.2: Long alpha-hairpin [46556] (14 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 437644Superfamily a.2.13: Transcriptional repressor TraM [109631] (1 family) (S)
    similar structure to L29p (scop_sf 46561); contains extra short helix; forms homodimer: an open bundle
  5. 437645Family a.2.13.1: Transcriptional repressor TraM [109632] (1 protein)
  6. 437646Protein Transcriptional repressor TraM [109633] (1 species)
  7. 437647Species Agrobacterium tumefaciens [TaxId:358] [109634] (2 PDB entries)
  8. 437649Domain d1us6b_: 1us6 B: [108000]

Details for d1us6b_

PDB Entry: 1us6 (more details), 1.65 Å

PDB Description: crystal structure of the quorum-sensing protein tram from agrobacterium tumefaciens at 1.65 ang. resolution

SCOP Domain Sequences for d1us6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1us6b_ a.2.13.1 (B:) Transcriptional repressor TraM {Agrobacterium tumefaciens}
meledanvtkkvelrpligltrglpptdletitidairthrrlvekadelfqalpetykt
gqacggpqhiryieasiemhaqmsalntlysilgfipkvv

SCOP Domain Coordinates for d1us6b_:

Click to download the PDB-style file with coordinates for d1us6b_.
(The format of our PDB-style files is described here.)

Timeline for d1us6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1us6a_