SCOPe 2.06: Domain d1us6a_: 1us6 A:

Lineage for d1us6a_ (1us6 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.13: Transcriptional repressor TraM [109631] (1 family)
   similar structure to L29p (46561); contains extra short helix; forms homodimer: an open bundle
   automatically mapped to Pfam PF09228

5. Family a.2.13.1: Transcriptional repressor TraM [109632] (2 proteins)

6. Protein Transcriptional repressor TraM [109633] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [109634] (3 PDB entries)
   Uniprot Q57471

8. Domain d1us6a_: 1us6 A: [107999]

Details for d1us6a_

PDB Entry: 1us6, 1.65 Å

PDB Description: crystal structure of the quorum-sensing protein tram from agrobacterium tumefaciens at 1.65 ang. resolution

PDB Compounds: (A:) transcriptional repressor tram

SCOPe Domain Sequences for d1us6a_:

Sequence; same for both SEQRES and ATOM records:

>d1us6a_ a.2.13.1 (A:) Transcriptional repressor TraM {Agrobacterium tumefaciens [TaxId: 358]}
velrpligltrglpptdletitidairthrrlvekadelfqalpetyktgqacggpqhir
yieasiemhaqmsalntlysilgfipkvvvn

Timeline for d1us6a_:

• d1us6a_ first appeared in SCOP 1.69
  
• d1us6a_ appears in SCOPe 2.05
  
• d1us6a_ appears in SCOPe 2.07
  
• d1us6a_ appears in the current release, SCOPe 2.08