![]() | Class h: Coiled coil proteins [57942] (6 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (28 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.15: SNARE fusion complex [58038] (1 family) ![]() tetrameric parallel coiled coil |
![]() | Family h.1.15.1: SNARE fusion complex [58039] (11 proteins) |
![]() | Protein Syntaxin 1A [88908] (2 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [88909] (6 PDB entries) a globular structure of a larger fragment containing this region is available; (1dn1), chain B |
![]() | Domain d1urqb_: 1urq B: [107995] Other proteins in same PDB: d1urqa_, d1urqc_, d1urqd_ |
PDB Entry: 1urq (more details), 2 Å
SCOP Domain Sequences for d1urqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1urqb_ h.1.15.1 (B:) Syntaxin 1A {Rat (Rattus norvegicus)} etrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravsdtkkav kyqs
Timeline for d1urqb_: