Lineage for d1urqb_ (1urq B:)

  1. Root: SCOP 1.69
  2. 525081Class h: Coiled coil proteins [57942] (6 folds)
  3. 525082Fold h.1: Parallel coiled-coil [57943] (28 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 525700Superfamily h.1.15: SNARE fusion complex [58038] (1 family) (S)
    tetrameric parallel coiled coil
  5. 525701Family h.1.15.1: SNARE fusion complex [58039] (11 proteins)
  6. 525746Protein Syntaxin 1A [88908] (2 species)
  7. 525749Species Rat (Rattus norvegicus) [TaxId:10116] [88909] (6 PDB entries)
    a globular structure of a larger fragment containing this region is available; (1dn1), chain B
  8. 525751Domain d1urqb_: 1urq B: [107995]
    Other proteins in same PDB: d1urqa_, d1urqc_, d1urqd_

Details for d1urqb_

PDB Entry: 1urq (more details), 2 Å

PDB Description: crystal structure of neuronal q-snares in complex with r-snare motif of tomosyn

SCOP Domain Sequences for d1urqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urqb_ h.1.15.1 (B:) Syntaxin 1A {Rat (Rattus norvegicus)}
etrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravsdtkkav
kyqs

SCOP Domain Coordinates for d1urqb_:

Click to download the PDB-style file with coordinates for d1urqb_.
(The format of our PDB-style files is described here.)

Timeline for d1urqb_: