Lineage for d1upga_ (1upg A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 531983Fold a.2: Long alpha-hairpin [46556] (13 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 532323Superfamily a.2.13: Transcriptional repressor TraM [109631] (1 family) (S)
    similar structure to L29p (scop_sf 46561); contains extra short helix; forms homodimer: an open bundle
  5. 532324Family a.2.13.1: Transcriptional repressor TraM [109632] (1 protein)
  6. 532325Protein Transcriptional repressor TraM [109633] (1 species)
  7. 532326Species Agrobacterium tumefaciens [TaxId:358] [109634] (3 PDB entries)
  8. 532331Domain d1upga_: 1upg A: [107992]

Details for d1upga_

PDB Entry: 1upg (more details), 1.8 Å

PDB Description: crystal structure of the quorum-sensing protein tram from agrobacterium tumefaciens

SCOP Domain Sequences for d1upga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upga_ a.2.13.1 (A:) Transcriptional repressor TraM {Agrobacterium tumefaciens}
velrpligltrglpptdletitidairthrrlvekadelfqalpetyktgqacggpqhir
yieasiemhaqmsalntlysilgfipkvvvn

SCOP Domain Coordinates for d1upga_:

Click to download the PDB-style file with coordinates for d1upga_.
(The format of our PDB-style files is described here.)

Timeline for d1upga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1upgb_