Lineage for d1up6h1 (1up6 H:2-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844316Protein 6-phospho-beta-glucosidase [110428] (2 species)
  7. 2844319Species Thermotoga maritima [TaxId:2336] [110430] (3 PDB entries)
    Uniprot Q9X108
  8. 2844335Domain d1up6h1: 1up6 H:2-162 [107990]
    Other proteins in same PDB: d1up6a2, d1up6b2, d1up6c2, d1up6d2, d1up6e2, d1up6f2, d1up6g2, d1up6h2
    complexed with g6p, mn, nad, so4

Details for d1up6h1

PDB Entry: 1up6 (more details), 2.55 Å

PDB Description: structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.55 angstrom resolution in the tetragonal form with manganese, nad+ and glucose-6-phosphate
PDB Compounds: (H:) 6-phospho-beta-glucosidase

SCOPe Domain Sequences for d1up6h1:

Sequence, based on SEQRES records: (download)

>d1up6h1 c.2.1.5 (H:2-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]}
riavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvli
sdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpive
eyvdtvrktsnativnftnpsghitefvrnyleyekfiglc

Sequence, based on observed residues (ATOM records): (download)

>d1up6h1 c.2.1.5 (H:2-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]}
riavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvli
sdtfegavvyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiveeyv
dtvrktsnativnftnpsghitefvrnyleyekfiglc

SCOPe Domain Coordinates for d1up6h1:

Click to download the PDB-style file with coordinates for d1up6h1.
(The format of our PDB-style files is described here.)

Timeline for d1up6h1: