![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
![]() | Family d.162.1.2: AglA-like glucosidase [90050] (5 proteins) family 4 glycosyl hydrolase automatically mapped to Pfam PF11975 |
![]() | Protein 6-phospho-beta-glucosidase [111254] (2 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [111256] (3 PDB entries) Uniprot Q9X108 |
![]() | Domain d1up6f2: 1up6 F:163-415 [107987] Other proteins in same PDB: d1up6a1, d1up6b1, d1up6c1, d1up6d1, d1up6e1, d1up6f1, d1up6g1, d1up6h1 complexed with g6p, mn, nad, so4 |
PDB Entry: 1up6 (more details), 2.55 Å
SCOPe Domain Sequences for d1up6f2:
Sequence, based on SEQRES records: (download)
>d1up6f2 d.162.1.2 (F:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} nvpinfireiaemfsarledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnip dedfptwfydsvrlivnpylryylmekkmfkkisthelrarevmkiekelfekyrtavei peeltkrggsmystaaahlirdletdegkihivntrnngsienlpddyvleipcyvrsgr vhtlsqgkgdhfalsfihavkmyerltieaylkrskklalkallshplgpdvedakdlle eileanreyvklg
>d1up6f2 d.162.1.2 (F:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} nvpinfireiaemfsarledvflkyyglnhlsfiekvfvkgedvtekvfenlklkedfpt wfydsvrlivnpylryylmekkmfkkisthelrarevmkiekelfekyrtaveipestaa ahlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsf ihavkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
Timeline for d1up6f2: