Lineage for d1up6d2 (1up6 D:163-415)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2557344Family d.162.1.2: AglA-like glucosidase [90050] (5 protein domains)
    family 4 glycosyl hydrolase
    automatically mapped to Pfam PF11975
  6. 2557345Protein 6-phospho-beta-glucosidase [111254] (2 species)
  7. 2557348Species Thermotoga maritima [TaxId:2336] [111256] (3 PDB entries)
    Uniprot Q9X108
  8. 2557352Domain d1up6d2: 1up6 D:163-415 [107983]
    Other proteins in same PDB: d1up6a1, d1up6b1, d1up6c1, d1up6d1, d1up6e1, d1up6f1, d1up6g1, d1up6h1
    complexed with g6p, mn, nad, so4

Details for d1up6d2

PDB Entry: 1up6 (more details), 2.55 Å

PDB Description: structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.55 angstrom resolution in the tetragonal form with manganese, nad+ and glucose-6-phosphate
PDB Compounds: (D:) 6-phospho-beta-glucosidase

SCOPe Domain Sequences for d1up6d2:

Sequence, based on SEQRES records: (download)

>d1up6d2 d.162.1.2 (D:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]}
nvpinfireiaemfsarledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnip
dedfptwfydsvrlivnpylryylmekkmfkkisthelrarevmkiekelfekyrtavei
peeltkrggsmystaaahlirdletdegkihivntrnngsienlpddyvleipcyvrsgr
vhtlsqgkgdhfalsfihavkmyerltieaylkrskklalkallshplgpdvedakdlle
eileanreyvklg

Sequence, based on observed residues (ATOM records): (download)

>d1up6d2 d.162.1.2 (D:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]}
nvpinfireiaemfsarledvflkyyglnhlsfiekvfvkgedvtekvfenlklpdedfp
twfydsvrlivnpylryylmekkmfkkisthelrarevmkiekelfekyrtaveipegsm
ystaaahlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdh
falsfihavkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvk
lg

SCOPe Domain Coordinates for d1up6d2:

Click to download the PDB-style file with coordinates for d1up6d2.
(The format of our PDB-style files is described here.)

Timeline for d1up6d2: