Lineage for d1up6a2 (1up6 A:163-415)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513617Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 513618Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 513795Family d.162.1.2: AglA-like glucosidase [90050] (4 proteins)
    family 4 glycosyl hydrolase
  6. 513796Protein 6-phospho-beta-glucosidase [111254] (2 species)
  7. 513799Species Thermotoga maritima [TaxId:243274] [111256] (1 PDB entry)
  8. 513800Domain d1up6a2: 1up6 A:163-415 [107977]
    Other proteins in same PDB: d1up6a1, d1up6b1, d1up6c1, d1up6d1, d1up6e1, d1up6f1, d1up6g1, d1up6h1

Details for d1up6a2

PDB Entry: 1up6 (more details), 2.55 Å

PDB Description: structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.55 angstrom resolution in the tetragonal form with manganese, nad+ and glucose-6-phosphate

SCOP Domain Sequences for d1up6a2:

Sequence, based on SEQRES records: (download)

>d1up6a2 d.162.1.2 (A:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima}
nvpinfireiaemfsarledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnip
dedfptwfydsvrlivnpylryylmekkmfkkisthelrarevmkiekelfekyrtavei
peeltkrggsmystaaahlirdletdegkihivntrnngsienlpddyvleipcyvrsgr
vhtlsqgkgdhfalsfihavkmyerltieaylkrskklalkallshplgpdvedakdlle
eileanreyvklg

Sequence, based on observed residues (ATOM records): (download)

>d1up6a2 d.162.1.2 (A:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima}
nvpinfireiaemfsarledvflkyyglnhlsfiekvfvkgedvtekvfenlklklpded
fptwfydsvrlivnpylryylmekkmfkkisthelrarevmkiekelfekyrtaveipee
ltkrggsmystaaahlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvht
lsqgkgdhfalsfihavkmyerltieaylkrskklalkallshplgpdvedakdlleeil
eanreyvklg

SCOP Domain Coordinates for d1up6a2:

Click to download the PDB-style file with coordinates for d1up6a2.
(The format of our PDB-style files is described here.)

Timeline for d1up6a2: