Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein 6-phospho-beta-glucosidase [110428] (2 species) |
Species Thermotoga maritima [TaxId:2336] [110430] (3 PDB entries) Uniprot Q9X108 |
Domain d1up6a1: 1up6 A:2-162 [107976] Other proteins in same PDB: d1up6a2, d1up6b2, d1up6c2, d1up6d2, d1up6e2, d1up6f2, d1up6g2, d1up6h2 complexed with g6p, mn, nad, so4 |
PDB Entry: 1up6 (more details), 2.55 Å
SCOPe Domain Sequences for d1up6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1up6a1 c.2.1.5 (A:2-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} riavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvli sdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpive eyvdtvrktsnativnftnpsghitefvrnyleyekfiglc
Timeline for d1up6a1: