Lineage for d1uowa_ (1uow A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 661406Fold b.7: C2 domain-like [49561] (4 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 661407Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
    two constituent families are related by circular permutation
  5. 661469Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 661493Protein Synaptogamin I [49576] (1 species)
    duplication: contains tandem repeat of two similar domains
  7. 661494Species Rat (Rattus norvegicus) [TaxId:10116] [49577] (7 PDB entries)
  8. 661496Domain d1uowa_: 1uow A: [107975]
    complexed with act, ca, gol

Details for d1uowa_

PDB Entry: 1uow (more details), 1.04 Å

PDB Description: calcium binding domain c2b
PDB Compounds: (A:) Synaptotagmin I

SCOP Domain Sequences for d1uowa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]}
sgggggileklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkr
lkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgyns
tgaelrhwsdmlanprrpiaqwhtlqveeevdamlav

SCOP Domain Coordinates for d1uowa_:

Click to download the PDB-style file with coordinates for d1uowa_.
(The format of our PDB-style files is described here.)

Timeline for d1uowa_: