Lineage for d1uova_ (1uov A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304037Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1304038Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 1304130Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 1304154Protein Synaptogamin I [49576] (2 species)
    duplication: contains tandem repeat of two similar domains
  7. 1304162Species Norway rat (Rattus norvegicus) [TaxId:10116] [49577] (7 PDB entries)
    Uniprot P21707 271-419 ! Uniprot P21707 271-419
  8. 1304166Domain d1uova_: 1uov A: [107974]
    complexed with ca, gol

Details for d1uova_

PDB Entry: 1uov (more details), 1.65 Å

PDB Description: calcium binding domain c2b
PDB Compounds: (A:) Synaptotagmin I

SCOPe Domain Sequences for d1uova_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uova_ b.7.1.2 (A:) Synaptogamin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
leklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktt
ikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrh
wsdmlanprrpiaqwhtlqveeevdamlav

SCOPe Domain Coordinates for d1uova_:

Click to download the PDB-style file with coordinates for d1uova_.
(The format of our PDB-style files is described here.)

Timeline for d1uova_: