Lineage for d1uoea_ (1uoe A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150492Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 2150493Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 2150504Family c.119.1.2: DAK1 [109613] (3 protein domains)
    Pfam PF02733
  6. 2150511Protein Dihydroxyacetone kinase subunit K, DhaK [109614] (1 species)
  7. 2150512Species Escherichia coli [TaxId:562] [109615] (4 PDB entries)
    Uniprot P76015 20-366
    gene product YcgT
  8. 2150517Domain d1uoea_: 1uoe A: [107972]
    complexed with gol, so4

Details for d1uoea_

PDB Entry: 1uoe (more details), 2 Å

PDB Description: crystal structure of the dihydroxyacetone kinase from e. coli in complex with glyceraldehyde
PDB Compounds: (A:) dihydroxyacetone kinase

SCOPe Domain Sequences for d1uoea_:

Sequence, based on SEQRES records: (download)

>d1uoea_ c.119.1.2 (A:) Dihydroxyacetone kinase subunit K, DhaK {Escherichia coli [TaxId: 562]}
qvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsghepmhcgyigqgml
sgacpgeiftsptpdkifecamqvdggegvlliiknytgdilnfetatellhdsgvkvtt
vvidddvavkdslytagrrgvantvlieklvgaaaergdsldacaelgrklnnqghsigi
algactvpaagkpsftladnemefgvgihgepgidrrpfssldntvdemfdtllvngsyh
rtlrfwdyqqgswqeeqqtkqplqsgdrvialvnnlgatplselygvynrlttrcqqagl
tiernligayctsldmtgfsitllkvddetlalwdapvhtpalnwgk

Sequence, based on observed residues (ATOM records): (download)

>d1uoea_ c.119.1.2 (A:) Dihydroxyacetone kinase subunit K, DhaK {Escherichia coli [TaxId: 562]}
qvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsghepmhcgyigqgml
sgacpgeiftsptpdkifecamqvdggegvlliiknytgdilnfetatellhdsgvkvtt
vvidddvavkdslytagrrgvantvlieklvgaaaergdsldacaelgrklnnqghsigi
algacladnemefgvgihgepgidrrpfssldntvdemfdtllvngsyhrtlrfwdyqqg
swqeeqqtkqplqsgdrvialvnnlgatplselygvynrlttrcqqagltiernligayc
tsldmtgfsitllkvddetlalwdapvhtpalnwgk

SCOPe Domain Coordinates for d1uoea_:

Click to download the PDB-style file with coordinates for d1uoea_.
(The format of our PDB-style files is described here.)

Timeline for d1uoea_: