Lineage for d1unra_ (1unr A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803238Protein Rac-alpha serine/threonine kinase [89355] (1 species)
  7. 2803239Species Human (Homo sapiens) [TaxId:9606] [89356] (4 PDB entries)
    Uniprot P31749 1-117
  8. 2803241Domain d1unra_: 1unr A: [107969]
    complexed with so4

Details for d1unra_

PDB Entry: 1unr (more details), 1.25 Å

PDB Description: crystal structure of the ph domain of pkb alpha in complex with a sulfate molecule
PDB Compounds: (A:) rac-alpha serine/threonine kinase

SCOPe Domain Sequences for d1unra_:

Sequence, based on SEQRES records: (download)

>d1unra_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]}
dvaivkegwlhkrgeyiktwrpryfllkndgtfigykerpqdvdqreaplnnfsvaqcql
mkterprpntfiirclqwttviertfhvetpeereewttaiqtvadglkkqeeeemdf

Sequence, based on observed residues (ATOM records): (download)

>d1unra_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]}
dvaivkegwlhkrgeyiktwrpryfllkndgtfigykerpreaplnnfsvaqcqlmkter
prpntfiirclqwttviertfhvetpeereewttaiqtvadglkkqeeeemdf

SCOPe Domain Coordinates for d1unra_:

Click to download the PDB-style file with coordinates for d1unra_.
(The format of our PDB-style files is described here.)

Timeline for d1unra_: