Lineage for d1unpa_ (1unp A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467364Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 467365Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 467366Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (24 proteins)
  6. 467437Protein Rac-alpha serine/threonine kinase [89355] (1 species)
  7. 467438Species Human (Homo sapiens) [TaxId:9606] [89356] (4 PDB entries)
  8. 467442Domain d1unpa_: 1unp A: [107967]

Details for d1unpa_

PDB Entry: 1unp (more details), 1.65 Å

PDB Description: crystal structure of the pleckstrin homology domain of pkb alpha

SCOP Domain Sequences for d1unpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1unpa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens)}
dvaivkegwlhkrgeyiktwrpryfllkndgtfigykerpqdvdqreaplnnfsvaqcql
mkterprpntfiirclqwttviertfhvetpeereewttaiqtvadglkkqeeeemdfr

SCOP Domain Coordinates for d1unpa_:

Click to download the PDB-style file with coordinates for d1unpa_.
(The format of our PDB-style files is described here.)

Timeline for d1unpa_: