Lineage for d1unpa_ (1unp A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2061578Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 protein domains)
    Pfam PF00169
  6. 2061729Protein Rac-alpha serine/threonine kinase [89355] (1 species)
  7. 2061730Species Human (Homo sapiens) [TaxId:9606] [89356] (4 PDB entries)
    Uniprot P31749 1-117
  8. 2061734Domain d1unpa_: 1unp A: [107967]

Details for d1unpa_

PDB Entry: 1unp (more details), 1.65 Å

PDB Description: crystal structure of the pleckstrin homology domain of pkb alpha
PDB Compounds: (A:) rac-alpha serine/threonine kinase

SCOPe Domain Sequences for d1unpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1unpa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]}
dvaivkegwlhkrgeyiktwrpryfllkndgtfigykerpqdvdqreaplnnfsvaqcql
mkterprpntfiirclqwttviertfhvetpeereewttaiqtvadglkkqeeeemdfr

SCOPe Domain Coordinates for d1unpa_:

Click to download the PDB-style file with coordinates for d1unpa_.
(The format of our PDB-style files is described here.)

Timeline for d1unpa_: