Lineage for d1unda_ (1und A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440012Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
    3 short helices; irregular array
  4. 440013Superfamily a.14.1: VHP, Villin headpiece domain [47050] (1 family) (S)
  5. 440014Family a.14.1.1: VHP, Villin headpiece domain [47051] (4 proteins)
  6. 440018Protein Advillin [109760] (1 species)
  7. 440019Species Human (Homo sapiens) [TaxId:9606] [109761] (1 PDB entry)
  8. 440020Domain d1unda_: 1und A: [107966]

Details for d1unda_

PDB Entry: 1und (more details)

PDB Description: solution structure of the human advillin c-terminal headpiece subdomain

SCOP Domain Sequences for d1unda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1unda_ a.14.1.1 (A:) Advillin {Human (Homo sapiens)}
ylseqdfvsvfgitrgqfaalpgwkqlqmkkekglf

SCOP Domain Coordinates for d1unda_:

Click to download the PDB-style file with coordinates for d1unda_.
(The format of our PDB-style files is described here.)

Timeline for d1unda_: