Lineage for d1umoa_ (1umo A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436083Protein Cytoglobin [109626] (1 species)
  7. 436084Species Human (Homo sapiens) [TaxId:9606] [109627] (4 PDB entries)
  8. 436089Domain d1umoa_: 1umo A: [107959]

Details for d1umoa_

PDB Entry: 1umo (more details), 2.59 Å

PDB Description: the crystal structure of cytoglobin: the fourth globin type discovered in man

SCOP Domain Sequences for d1umoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umoa_ a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens)}
elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
efasdfppetqrawaklrgliyshvtaaykevgw

SCOP Domain Coordinates for d1umoa_:

Click to download the PDB-style file with coordinates for d1umoa_.
(The format of our PDB-style files is described here.)

Timeline for d1umoa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1umob_