Lineage for d1umfc_ (1umf C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009030Fold d.258: Chorismate synthase, AroC [103262] (1 superfamily)
    duplication: consists of two DCoH-like beta(2)-alpha-beta(2)-alpha structural repeats; 3 layers, beta/alpha/beta
  4. 3009031Superfamily d.258.1: Chorismate synthase, AroC [103263] (2 families) (S)
  5. 3009032Family d.258.1.1: Chorismate synthase, AroC [103264] (2 proteins)
    automatically mapped to Pfam PF01264
  6. 3009033Protein Chorismate synthase, AroC [103265] (7 species)
  7. 3009054Species Helicobacter pylori [TaxId:210] [111183] (2 PDB entries)
    Uniprot P56122
  8. 3009061Domain d1umfc_: 1umf C: [107954]

Details for d1umfc_

PDB Entry: 1umf (more details), 2.25 Å

PDB Description: crystal structure of chorismate synthase
PDB Compounds: (C:) Chorismate synthase

SCOPe Domain Sequences for d1umfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umfc_ d.258.1.1 (C:) Chorismate synthase, AroC {Helicobacter pylori [TaxId: 210]}
mntlgrflrlttfgeshgdviggvldgmpsgikidyallenemkrrqggrnvfitprked
dkveitsgvfedfstgtpigflihnqrarskdydniknlfrpshadftyfhkygirdfrg
ggrssaresairvaagafakmllreigivcesgiieiggikaknydfnhalkseifalde
eqeeaqktaiqnaiknhdsiggvalirarsiktnqklpiglgqglyakldakiaeammgl
ngvkaveigkgvessllkgseyndlmdqkgflsnrsggvlggmsngeeiivrvhfkptps
ifqpqrtidingnececllkgrhdpciairgsvvcesllalvladmvllnltskieylkt
iynen

SCOPe Domain Coordinates for d1umfc_:

Click to download the PDB-style file with coordinates for d1umfc_.
(The format of our PDB-style files is described here.)

Timeline for d1umfc_: