Lineage for d1um2a3 (1um2 A:582-698)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 868707Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 868716Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 868773Family d.95.2.2: Intein endonuclease [55614] (2 proteins)
    duplication: contains tandem repeat of this fold
  6. 868778Protein VMA1-derived endonuclease (VDE) PI-SceI [55615] (1 species)
    homing endonuclease with protein splicing activity
  7. 868779Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55616] (7 PDB entries)
    Uniprot P17255 284-737
  8. 868795Domain d1um2a3: 1um2 A:582-698 [107948]
    Other proteins in same PDB: d1um2a1, d1um2b1

Details for d1um2a3

PDB Entry: 1um2 (more details), 2.9 Å

PDB Description: crystal structure of the vma1-derived endonuclease with the ligated extein segment
PDB Compounds: (A:) endonuclease pi-scei

SCOP Domain Sequences for d1um2a3:

Sequence, based on SEQRES records: (download)

>d1um2a3 d.95.2.2 (A:582-698) VMA1-derived endonuclease (VDE) PI-SceI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslg
lvvsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafare

Sequence, based on observed residues (ATOM records): (download)

>d1um2a3 d.95.2.2 (A:582-698) VMA1-derived endonuclease (VDE) PI-SceI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslg
lvvsvnaepisyaiymsggdvllnvlskcagskkfrpapaaafare

SCOP Domain Coordinates for d1um2a3:

Click to download the PDB-style file with coordinates for d1um2a3.
(The format of our PDB-style files is described here.)

Timeline for d1um2a3: